Recombinant Cyprinus carpio Granulin-3 | CSB-EP301441EQE

(No reviews yet) Write a Review
SKU:
CSB-EP301441EQE
Availability:
13 - 23 Working Days
€352.00 - €1,702.00

Description

Recombinant Cyprinus carpio Granulin-3 | CSB-EP301441EQE | Cusabio

Alternative Name(s): Granulin-3

Gene Names: N/A

Research Areas: Others

Organism: Cyprinus carpio (Common carp)

AA Sequence: VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-57aa

Sequence Info: Full Length

MW: 13.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

Reference: "Isolation and primary structure of the three major forms of granulin-like peptides from hematopoietic tissues of a teleost fish (Cyprinus carpio)." Belcourt D.R., Lazure C., Bennett H.P. J. Biol. Chem. 268:9230-9237(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.

Function: Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Granulin family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P81015

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose