Recombinant Ctenocephalides felis Salivary antigen 1 | CSB-YP835981CTP

Recombinant Ctenocephalides felis Salivary antigen 1 | CSB-YP835981CTP | Cusabio

Alternative Name(s): FS-I Allergen: Cte f 1

Gene Names: N/A

Research Areas: Others

Organism: Ctenocephalides felis (Cat flea)

AA Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-176aa

Sequence Info: Full Length of Mature Protein

MW: 20.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Salivary antigens of Ctenocephalides felis: collection, purification and evaluation by intradermal skin testing in dogs."Frank G.R., Hunter S.W., Wallenfels L.J., Kwochka K.(In) Kwochka K., Von Tscharner C., Willemse T. (eds.); Advances in veterinary dermatology, pp.3:201-212, Butterworth-Heinemann Medical, Oxford (1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q94424

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A