Recombinant Cricetulus griseus Glutamine synthetase (GLUL) | CSB-EP009553DXU

Recombinant Cricetulus griseus Glutamine synthetase (GLUL) | CSB-EP009553DXU | Cusabio

Alternative Name(s): GS Glutamate decarboxylase Glutamate--ammonia ligase

Gene Names: GLUL

Research Areas: Neuroscience

Organism: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

AA Sequence: ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRHRYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGVADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAVTEAIVRTCLLNETGDQPFQYKN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-373aa

Sequence Info: Full Length of Mature Protein

MW: 58.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity).

Reference: "The cloning and nucleotide sequence of cDNA for an amplified glutamine synthetase gene from the Chinese hamster."Hayward B.E., Hussain A., Wilson R.H., Lyons A., Woodcock V., McIntosh B., Harris T.J.R.Nucleic Acids Res. 14:999-1008(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions

Involvement in disease:

Subcellular Location: Cytoplasm, Mitochondrion

Protein Families: Glutamine synthetase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04773

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A