Cusabio Bos taurus Recombinants
Recombinant Bovine Serum amyloid A protein (SAA1) | CSB-EP020656BOa0
- SKU:
- CSB-EP020656BOa0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bovine Serum amyloid A protein (SAA1) | CSB-EP020656BOa0 | Cusabio
Alternative Name(s): Amyloid fibril protein AA
Gene Names: SAA1
Research Areas: Cardiovascular
Organism: Bos taurus (Bovine)
AA Sequence: QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 19-130aa
Sequence Info: Full Length of Mature Protein
MW: 18.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: "The complete amino acid sequence of bovine serum amyloid protein A (SAA) and of subspecies of the tissue-deposited amyloid fibril protein A." Rossevatin K., Andresen P.K., Sletten K., Husebekk A., Husby G., Nordstoga K., Johnson K.H., Westermark G.T., Westermark P. Scand. J. Immunol. 35:217-224(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P35541
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A