Recombinant Bovine Serum amyloid A protein (SAA1) | CSB-EP020656BO

Recombinant Bovine Serum amyloid A protein (SAA1) | CSB-EP020656BO | Cusabio

Alternative Name(s): Amyloid fibril protein AA (SAA)

Gene Names: SAA1

Research Areas: Cardiovascular

Organism: Bos taurus (Bovine)

AA Sequence: QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 19-130aa

Sequence Info: Full Length of Mature Protein

MW: 30.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: "A unique insertion in the primary structure of bovine amyloid AA protein." Benson M.D., Dibartola S.P., Dwulet F.E. J. Lab. Clin. Med. 113:67-72(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major acute phase reactant. Apolipoprotein of the HDL complex.

Involvement in disease: Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular Location: Secreted

Protein Families: SAA family

Tissue Specificity: Expressed by the liver; secreted in plasma.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35541

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A