Recombinant Bovine Serpin A3-2 (SERPINA3-2) | CSB-YP382095BO

Recombinant Bovine Serpin A3-2 (SERPINA3-2) | CSB-YP382095BO | Cusabio

Alternative Name(s): SERPINA3-2; Serpin A3-2

Gene Names: SERPINA3-2

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: LPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGVAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-411aa

Sequence Info: Full Length of Mature Protein

MW: 45.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Serine protease inhibitor.

Reference: An original SERPINA3 gene cluster elucidation of genomic organization and gene expression in the Bos taurus 21q24 region.Pelissier P., Delourme D., Germot A., Blanchet X., Becila S., Maftah A., Leveziel H., Ouali A., Bremaud L.BMC Genomics 9:151-151(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serine protease inhibitor.

Involvement in disease:

Subcellular Location: Cytoplasmic vesicle, secretory vesicle, chromaffin granule, Secreted

Protein Families: Serpin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A2I7M9

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A