Recombinant Bovine Selenoprotein P (SELENOP) (U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S) | CSB-EP021018BO

(No reviews yet) Write a Review
SKU:
CSB-EP021018BO
Availability:
13 - 23 Working Days
  • Recombinant Bovine Selenoprotein P (SELENOP) (U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Bovine Selenoprotein P (SELENOP) (U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S) | CSB-EP021018BO | Cusabio

Alternative Name(s): Selenoprotein P-like protein

Gene Names: SELENOP

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 20-402aa (U59S,U297S,U307S,U338S,U350S,U363S,U365S,U372S,U388S,U390S,U397S,U399S)

Sequence Info: Full Length of Mature Protein

MW: 70.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Reference: Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.Saijoh K., Saito N., Lee M.J., Fujii M., Kobayashi T., Sumino K.Brain Res. Mol. Brain Res. 30:301-311(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Selenoprotein P family

Tissue Specificity: Brain and kidney. Most prominently expressed in the cerebellar cortex, hippocampus and olfactory bulb.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49907

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose