Cusabio Bos taurus Recombinants
Recombinant Bovine Resistin (RETN) | CSB-EP019573BO
- SKU:
- CSB-EP019573BO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bovine Resistin (RETN) | CSB-EP019573BO | Cusabio
Alternative Name(s): RETN; RSTN; Resistin
Gene Names: RETN
Research Areas: Others
Organism: Bos taurus (Bovine)
AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 19-109aa
Sequence Info: Full Length of Mature Protein
MW: 13.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes .
Reference: Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers.Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S.Anim. Sci. J. 76:567-573(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Resistin/FIZZ family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q762I5
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A