Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB), partial | CSB-EP021173BO1

(No reviews yet) Write a Review
SKU:
CSB-EP021173BO1
Availability:
13 - 23 Working Days
  • Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB), partial | CSB-EP021173BO1 | Cusabio

Alternative Name(s): 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Gene Names: SFTPB

Research Areas: Cell Biology

Organism: Bos taurus (Bovine)

AA Sequence: AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-187aa

Sequence Info: Partial

MW: 23.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Reference: "Characterization of the small hydrophobic proteins associated with pulmonary surfactant." Yu S.-H., Chung W., Olafson R.W., Harding P.G.R., Possmayer F. Biochim. Biophys. Acta 921:437-448(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, surface film

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15781

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose