Cusabio Bos taurus Recombinants
Recombinant Bovine Odorant-binding protein | CSB-YP362133BOa4
- SKU:
- CSB-YP362133BOa4
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bovine Odorant-binding protein | CSB-YP362133BOa4 | Cusabio
Alternative Name(s): Olfactory mucosa pyrazine-binding protein
Gene Names: N/A
Research Areas: Others
Organism: Bos taurus (Bovine)
AA Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
Expression Region: 1-159aa
Sequence Info: Full Length
MW: 34.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: This protein binds a wide variety of chemical odorants.
Reference: "Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: This protein binds a wide variety of chemical odorants.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Calycin superfamily, Lipocalin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07435
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A