Recombinant Bovine Decorin (DCN) | CSB-YP006554BO

Recombinant Bovine Decorin (DCN) | CSB-YP006554BO | Cusabio

Alternative Name(s): Bone proteoglycan II PG-S2

Gene Names: DCN

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-360aa

Sequence Info: Full Length of Mature Protein

MW: 38.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May affect the rate of fibrils formation.

Reference: "Molecular cloning and sequence analysis of the cDNA for small proteoglycan II of bovine bone."Day A.A., McQuillan C.I., Termine J.D., Young M.R.Biochem. J. 248:801-805(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May affect the rate of fibrils formation.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21793

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A