Recombinant Bovine Cytosol aminopeptidase (LAP3), partial | CSB-EP632987BO

Recombinant Bovine Cytosol aminopeptidase (LAP3), partial | CSB-EP632987BO | Cusabio

Alternative Name(s): Leucine aminopeptidase 3 ;LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase

Gene Names: LAP3

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-64aa

Sequence Info: Partial

MW: 20.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides.

Reference: The genome sequence of taurine cattle a window to ruminant biology and evolution.The bovine genome sequencing and analysis consortiumScience 324:522-528(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Peptidase M17 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00727

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A