Recombinant Bordetella bronchiseptica Azurin (BB3856) | CSB-YP358313BTY

Recombinant Bordetella bronchiseptica Azurin (BB3856) | CSB-YP358313BTY | Cusabio

Alternative Name(s): BB3856Azurin

Gene Names: BB3856

Research Areas: Others

Organism: Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

AA Sequence: AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-150aa

Sequence Info: Full Length of Mature Protein

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Species differences in the amino-acid sequences of bacterial proteins." Ambler R.P. (In) Hawkes J.G. (eds.); Chemotaxonomy and serotaxonomy, pp.57-64, Academic Press, London (1968)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Periplasm

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A321

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A