Recombinant Bombyx mori Prothoracicotropic hormone | CSB-EP324609BTT

Recombinant Bombyx mori Prothoracicotropic hormone | CSB-EP324609BTT | Cusabio

Alternative Name(s): ; Prothoracicotropic hormone; PTTH) [Cleaved into: P2K; P6K; Prothoracicotropic hormone]

Gene Names: N/A

Research Areas: Others

Organism: Bombyx mori (Silk moth)

AA Sequence: GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 116-224aa

Sequence Info: Full Length of Mature Protein

MW: 16.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions.

Reference: Molecular cloning of the Bombyx mori prothoracicotropic hormone.Kawakami A., Kataoka H., Oka T., Mizoguchi A., Kimura-Kawakami M., Adachi T., Iwami M., Nagasawa H., Suzuki A., Ishizaki H.Science 247:1333-1335(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.; FUNCTION

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17219

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A