Cusabio Virus & Bacteria Recombinants
Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA) | CSB-EP322213BSS
- SKU:
- CSB-EP322213BSS
- Availability:
- 3 - 7 Working Days
Description
Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA) | CSB-EP322213BSS | Cusabio
Alternative Name(s): Allergen Bet v I-A Allergen: Bet v 1-A
Gene Names: BETVIA
Research Areas: Allergen
Organism: Betula pendula (European white birch) (Betula verrucosa)
AA Sequence: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-160aa
Sequence Info: Full Length of Mature Protein
MW: 33.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May be a general steroid carrier protein.
Reference: "The gene coding for the major birch pollen allergen Betv1, is highly homologous to a pea disease resistance response gene."Breiteneder H., Pettenburger K., Bito A., Valenta R., Kraft D., Rumpold H., Scheiner O., Breitenbach M.EMBO J. 8:1935-1938(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be a general steroid carrier protein.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: BetVI family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P15494
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A