Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA) | CSB-EP322213BSS

(No reviews yet) Write a Review
SKU:
CSB-EP322213BSS
Availability:
3 - 7 Working Days
  • Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA) | CSB-EP322213BSS | Cusabio

Alternative Name(s): Allergen Bet v I-A Allergen: Bet v 1-A

Gene Names: BETVIA

Research Areas: Allergen

Organism: Betula pendula (European white birch) (Betula verrucosa)

AA Sequence: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-160aa

Sequence Info: Full Length of Mature Protein

MW: 33.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be a general steroid carrier protein.

Reference: "The gene coding for the major birch pollen allergen Betv1, is highly homologous to a pea disease resistance response gene."Breiteneder H., Pettenburger K., Bito A., Valenta R., Kraft D., Rumpold H., Scheiner O., Breitenbach M.EMBO J. 8:1935-1938(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be a general steroid carrier protein.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: BetVI family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15494

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose