Recombinant Aspergillus niger 3-phytase A (phyA) | CSB-EP333934DOZ

Recombinant Aspergillus niger 3-phytase A (phyA) | CSB-EP333934DOZ | Cusabio

Alternative Name(s): 3 phytase AMyo-inositol hexakisphosphate phosphohydrolase AMyo-inositol-hexaphosphate 3-phosphohydrolase A

Gene Names: phyA

Research Areas: Others

Organism: Aspergillus niger

AA Sequence: ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-467aa

Sequence Info: Full Length of Mature Protein

MW: 64.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Reference: Crystal structure of phytase from Aspergillus ficuum at 2.5-A resolution.Kostrewa D., Gruninger-Leitch F., D'Arcy A., Broger C., Mitchell D., van Loon A.P.G.M.Nat. Struct. Biol. 4:185-190(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Histidine acid phosphatase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34752

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A