Recombinant Aspergillus giganteus Antifungal protein (afp) | CSB-EP325933APN

Recombinant Aspergillus giganteus Antifungal protein (afp) | CSB-EP325933APN | Cusabio

Alternative Name(s): afpAntifungal protein

Gene Names: afp

Research Areas: Microbiology

Organism: Aspergillus giganteus

AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 44-94aa

Sequence Info: Full Length of Mature Protein

MW: 19.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein inhibits the growth of a variety of fungal species.

Reference: "NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism."Campos-Olivas R., Bruix M., Santoro J., Lacadena J., Martinez del Pozo A., Gavilanes J.G., Rico M.Biochemistry 34:3009-3021(1995) .

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein inhibits the growth of a variety of fungal species.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17737

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A