Cusabio Virus & Bacteria Recombinants
Recombinant Ascaris suum Major pepsin inhibitor 3 | CSB-EP322527DOS
- SKU:
- CSB-EP322527DOS
- Availability:
- 13 - 23 Working Days
Description
Recombinant Ascaris suum Major pepsin inhibitor 3 | CSB-EP322527DOS | Cusabio
Alternative Name(s): Short name: PI-3
Gene Names: N/A
Research Areas: Others
Organism: Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
AA Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 21-169aa
Sequence Info: Full Length of Mature Protein
MW: 32.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: This is an inhibitor of the aspartic protease pepsin.
Reference: "Molecular cloning, expression and characterization of an Ascaris inhibitor for pepsin and cathepsin E."Kageyama T.Eur. J. Biochem. 253:804-809(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: This is an inhibitor of the aspartic protease pepsin.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Protease inhibitor I33 family
Tissue Specificity: Body wall.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P19400
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A