Recombinant Arthrobacter globiformis Uricase (uox), partial | CSB-YP025648DOH

Recombinant Arthrobacter globiformis Uricase (uox), partial | CSB-YP025648DOH | Cusabio

Alternative Name(s): Urate oxidase Short name: AgUOX

Gene Names: uox

Research Areas: Others

Organism: Arthrobacter globiformis

AA Sequence: TKVVLGQNQYGKAEVRLVKVTRNTARHEIQDLNVTSQLRGDFEAAHTAGDNAHVVATDTQKNTVYAFARDGFATTEEFLLRLGKHFTEGFDWVTGGRWAAQQFFWDRINDHDHAFSRNKSEVRTAVLEISGSEQAIVAGIEGLTVLKSTGSEFHGFPRDKYTTLQETTDRILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQQTMYEMGRAVIETHPEIDEIKMSLPNKHHFLVDLQPFGQDNPNEVFYAADRPYGLIEATIQREGSRADHPIWSN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 11-297aa

Sequence Info: Partial

MW: 34.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.

Reference: "Structures of Arthrobacter globiformis urate oxidase-ligand complexes."Juan E.C., Hoque M.M., Shimizu S., Hossain M.T., Yamamoto T., Imamura S., Suzuki K., Tsunoda M., Amano H., Sekiguchi T., Takenaka A.Acta Crystallogr. D 64:815-822(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: D0VWQ1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A