Recombinant Artemisia vulgaris Non-specific lipid-transfer protein | CSB-EP020856AOH

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein | CSB-EP020856AOH | Cusabio

Alternative Name(s): Pollen allergen Art v 3 Allergen: Art v 3

Gene Names: N/A

Research Areas: Others

Organism: Artemisia vulgaris (Mugwort)

AA Sequence: ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

Source: E.coli

Tag Info: Tag-Free

Expression Region: 1-37aa

Sequence Info: Full Length of Mature Protein

MW: 3.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues

Reference: "Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families: Plant LTP family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0C088

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A