Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2) | CSB-YP651993DOA

Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2) | CSB-YP651993DOA | Cusabio

Alternative Name(s): Short name:CDKB1;2

Gene Names: CDKB1-2

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-311aa

Sequence Info: Full Length

MW: 37.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: ATP + a protein = ADP + a phosphoprotein. ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate.

Reference: "Identification of novel cyclin-dependent kinases interacting with the CKS1 protein of Arabidopsis."Boudolf V., Rombauts S., Naudts M., Inze D., de Veylder L.J. Exp. Bot. 52:1381-1382(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata

Involvement in disease:

Subcellular Location:

Protein Families: Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily

Tissue Specificity: Expressed in flowers.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q2V419

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A