Recombinant Androctonus mauritanicus mauritanicus Alpha-toxin Amm8 | CSB-BP773772AKB

Recombinant Androctonus mauritanicus mauritanicus Alpha-toxin Amm8 | CSB-BP773772AKB | Cusabio

Alternative Name(s): Alpha-anatoxin Amm VIII (Amm VIII)

Gene Names: N/A

Research Areas: Others

Organism: Androctonus mauritanicus mauritanicus (Scorpion)

AA Sequence: LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 20-84aa

Sequence Info: Full Length of Mature Protein

MW: 11.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission.

Reference: "Characterization of Amm VIII from Androctonus mauretanicus mauretanicus: a new scorpion toxin that discriminates between neuronal and skeletal sodium channels." Alami M., Vacher H., Bosmans F., Devaux C., Rosso J.-P., Bougis P.E., Tytgat J., Darbon H., Martin-Eauclaire M.-F. Biochem. J. 375:551-560(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7YXD3

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A