Cusabio Virus & Bacteria Recombinants
Recombinant Androctonus australis Alpha-mammal toxin AaH2 | CSB-EP355659AJZ
- SKU:
- CSB-EP355659AJZ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Androctonus australis Alpha-mammal toxin AaH2 | CSB-EP355659AJZ | Cusabio
Alternative Name(s): AaH II Short name:AaHII Neurotoxin 2
Gene Names: N/A
Research Areas: Others
Organism: Androctonus australis (Sahara scorpion)
AA Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-83aa
Sequence Info: Full Length of Mature Protein
MW: 23.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.
Reference: "Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II."Bougis P.E., Rochat H., Smith L.A.J. Biol. Chem. 264:19259-19265(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily
Tissue Specificity: Expressed by the venom gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P01484
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A