Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70) | CSB-YP302100AZV

(No reviews yet) Write a Review
SKU:
CSB-YP302100AZV
Availability:
25 - 35 Working Days
  • Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70) | CSB-YP302100AZV | Cusabio

Alternative Name(s): Allergen: Alt a 3

Gene Names: HSP70

Research Areas: Signal Transduction

Organism: Alternaria alternata (Alternaria rot fungus) (Torula alternata)

AA Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-152aa

Sequence Info: Full Length

MW: 18.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Molecular cloning of IgE-binding fragments of Alternaria alternata allergens."De Vouge M.W., Thaker A.J., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 116:261-268(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Heat shock protein 70 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P78983

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose