Recombinant African swine fever virus Major structural protein p17 (Ba71V-107) | CSB-CF806121AEJ

(No reviews yet) Write a Review
SKU:
CSB-CF806121AEJ
Availability:
3 - 7 Working Days
£991.20 - £1,688.80

Description

Recombinant African swine fever virus Major structural protein p17 (Ba71V-107) | CSB-CF806121AEJ | Cusabio

Alternative Name(s): Ba71V-107; D117L; Major structural protein p17

Gene Names: Ba71V-107

Research Areas: Others

Organism: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

AA Sequence: MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-117aa

Sequence Info: Full Length

MW: 19.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories.

Reference: "African swine fever virus protein p17 is essential for the progression of viral membrane precursors toward icosahedral intermediates." Suarez C., Gutierrez-Berzal J., Andres G., Salas M.L., Rodriguez J.M. J. Virol. 84:7484-7499(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q89424

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose