Cusabio Virus & Bacteria Recombinants
Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) | CSB-EP301302DUS
- SKU:
- CSB-EP301302DUS
- Availability:
- 3 - 7 Working Days
Description
Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) | CSB-EP301302DUS | Cusabio
Alternative Name(s): CLOST_2292Ferredoxin
Gene Names: CLOST_2292
Research Areas: Others
Organism: Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii)
AA Sequence: AYVINDSCISCGACEPECPVNAITAGDDKYVIDAATCIDCGACAGVCPVDAPQPE
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 2-56aa
Sequence Info: Full Length of Mature Protein
MW: 13.0 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Reference: "Sequences of clostridial ferredoxins: determination of the Clostridium sticklandii sequence and correction of the Clostridium acidurici sequence." Meyer J., Moulis J.-M., Scherrer N., Gagnon J., Ulrich J. Biochem. J. 294:622-623(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P80168
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A