Recombinant Rat Fibroblast growth factor 23 (Fgf23) | CSB-EP008629RA

(No reviews yet) Write a Review
SKU:
CSB-EP008629RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Fibroblast growth factor 23 (Fgf23)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Rat Fibroblast growth factor 23 (Fgf23) | CSB-EP008629RA | Cusabio

Alternative Name(s): Fgf23Fibroblast growth factor 23; FGF-23

Gene Names: Fgf23

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-251aa

Sequence Info: Full Length of Mature Protein

MW: 29.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Reference: Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulator of phosphate homeostasis (By similarity). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity). Regulator of vitamin-D metabolism (By similarity). Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity: Expressed in the parathyroid.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8VI82

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose