Cusabio Virus & Bacteria Recombinants
Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial | CSB-YP006696EXPe0
- SKU:
- CSB-YP006696EXPe0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial | CSB-YP006696EXPe0 | Cusabio
Alternative Name(s): Defensin, beta 126
Gene Names: DEFB126
Research Areas: Others
Organism: Pongo pygmaeus (Bornean orangutan)
AA Sequence: SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Source: Yeast
Tag Info: N-terminal GST-tagged
Expression Region: 21-63aa
Sequence Info: Partial
MW: 31.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Has antibacterial activity.Curated
Reference: Evolution and sequence variation of human beta-defensin genes.Hollox E.J., Armour J.A.L.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Beta-defensin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: A4H244
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A