Recombinant Mouse Uroplakin-2 (Upk2) | CSB-EP025656MO

Recombinant Mouse Uroplakin-2 (Upk2) | CSB-EP025656MO | Cusabio

Alternative Name(s): Uroplakin II

Gene Names: Upk2

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 85-184aa

Sequence Info: Full Length of Mature Protein

MW: 40.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Reference: "A tissue-specific promoter that can drive a foreign gene to express in the suprabasal urothelial cells of transgenic mice." Lin J.-H., Zhao H., Sun T.-T. Proc. Natl. Acad. Sci. U.S.A. 92:679-683(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Uroplakin-2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P38575

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A