Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) | CSB-MP770515MO

Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) | CSB-MP770515MO | Cusabio

Alternative Name(s): Nmes1Normal mucosa of esophagus-specific gene 1 protein

Gene Names: Nmes1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR

Source: Mammalian cell

Tag Info: C-terminal Flag-Myc-tagged

Expression Region: 1-83aa

Sequence Info: Full Length

MW: 12.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: A novel gene, NMES1, downregulated in human esophageal squamous cell carcinoma.Zhou J., Wang H., Lu A., Hu G., Luo A., Ding F., Zhang J., Wang X., Wu M., Liu Z.Int. J. Cancer 101:311-316(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Complex I NDUFA4 subunit family

Tissue Specificity: Strongly expressed in vertebrae, brain, intestine and stomach.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q810Q5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A