null

Recombinant Human Mammaglobin-A (SCGB2A2) | CSB-YP622649HU

(No reviews yet) Write a Review
SKU:
CSB-YP622649HU
Availability:
25 - 35 Working Days
€262.00 - €943.00
Frequently bought together:

Description

Recombinant Human Mammaglobin-A (SCGB2A2) | CSB-YP622649HU | Cusabio

Alternative Name(s): Mammaglobin-1 (Secretoglobin family 2A member 2)

Gene Names: SCGB2A2

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-93aa

Sequence Info: Full Length of Mature Protein

MW: 10.5

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Highly sensitive detection of the MGB1 transcript (mammaglobin) in the peripheral blood of breast cancer patients." Cerveira N., Torres L., Rocha P., Bizarro S., Pereira D., Abreu J., Henrique R., Teixeira M.R., Castedo S. Int. J. Cancer 108:592-595(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q13296

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose