Recombinant Human L-lactate dehydrogenase C chain (LDHC) , partial | CSB-BP012844HU

(No reviews yet) Write a Review
SKU:
CSB-BP012844HU
Availability:
28 - 38 Working Days
  • Recombinant Human L-lactate dehydrogenase C chain (LDHC) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€360.00 - €1,556.00

Description

Recombinant Human L-lactate dehydrogenase C chain (LDHC) , partial | CSB-BP012844HU | Cusabio

Alternative Name(s): Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X

Gene Names: LDHC

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-332aa

Sequence Info: Extracellular Domain

MW: 38.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Possible role in sperm motility.

Reference: "Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence."Millan J.L., Driscoll C.E., Goldberg E.Proc. Natl. Acad. Sci. U.S.A. 84:5311-5315(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possible role in sperm motility.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: LDH/MDH superfamily, LDH family

Tissue Specificity:

Paythway: Glucagonsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07864

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose