Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT) | CSB-EP843276HU

(No reviews yet) Write a Review
SKU:
CSB-EP843276HU
Availability:
13 - 23 Working Days
  • Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT) | CSB-EP843276HU | Cusabio

Alternative Name(s): 2-aminoadipate aminotransferase2-aminoadipate transaminase (EC:2.6.1.39)Alpha-aminoadipate aminotransferase ;AadATKynurenine aminotransferase IIKynurenine--oxoglutarate aminotransferase IIKynurenine--oxoglutarate transaminase 2 (EC:2.6.1.7)Kynurenine--oxoglutarate transaminase II

Gene Names: AADAT

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-425aa

Sequence Info: Full Length of Mature Protein

MW: 60.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).

Reference: Crystal structure of human kynurenine aminotransferase II, a drug target for the treatment of schizophrenia.Rossi F., Garavaglia S., Montalbano V., Walsh M.A., Rizzi M.J. Biol. Chem. 283:3559-3566(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: Class-I pyridoxal-phosphate-dependent aminotransferase family

Tissue Specificity: Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8N5Z0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose