Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) (Active) | CSB-AP004601HU

Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) (Active) | CSB-AP004601HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; IL1RN; IL1F3; IL1RA

Gene Names: IL1RN

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 26-177aa

Sequence Info: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Biological Activity: The ED50 as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells is typically 0.5 ng/mL.

MW: 17.26 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.

Involvement in disease: Microvascular complications of diabetes 4 (MVCD4) ; Interleukin 1 receptor antagonist deficiency (DIRA)

Subcellular Location: Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm

Protein Families:

Tissue Specificity: The intracellular form of IL1RN is predominantly expressed in epithelial cells.

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18510

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM