Recombinant Human Creatine kinase U-type, mitochondrial (CKMT1A) | CSB-RP098174h

(No reviews yet) Write a Review
SKU:
CSB-RP098174h
Availability:
3 - 7 Working Days
  • Recombinant Human Creatine kinase U-type, mitochondrial (CKMT1A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Creatine kinase U-type, mitochondrial (CKMT1A) | CSB-RP098174h | Cusabio

Alternative Name(s): Acidic-type mitochondrial creatine kinase ;Mia-CKUbiquitous mitochondrial creatine kinase ;U-MtCK

Gene Names: CKMT1A

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 40-417aa

Sequence Info: Full Length of Mature Protein

MW: 47.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy dands, such as skeletal muscle, heart, brain and spermatozoa.

Reference: Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W.J. Biol. Chem. 264:2890-2897(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Intermembrane side

Protein Families: ATP:guanido phosphotransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12532

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose