Recombinant Human Complement C5 (C5) , partial | CSB-EP003995HU

Recombinant Human Complement C5 (C5) , partial | CSB-EP003995HU | Cusabio

Alternative Name(s): C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4

Gene Names: C5

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 678-751aa

Sequence Info: Partial

MW: 24.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Activation of C5 by a C5 convertase initiates the spontaneous assbly of the late complent components, C5-C9, into the mbrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assbled.Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes . C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Reference: Complete cDNA sequence of human complement pro-C5. Evidence of truncated transcripts derived from a single copy gene.Haviland D.L., Haviland J.C., Fleischer D.T., Hunt A., Wetsel R.A.J. Immunol. 146:362-368(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; FUNCTION

Involvement in disease: Complement component 5 deficiency (C5D)

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway: Complementandcoagulationcascades

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01031

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM