Recombinant Human Ciliary neurotrophic factor (CNTF) | CSB-BP005683HU

(No reviews yet) Write a Review
SKU:
CSB-BP005683HU
Availability:
28 - 38 Working Days
€306.00 - €1,253.00

Description

Recombinant Human Ciliary neurotrophic factor (CNTF) | CSB-BP005683HU | Cusabio

Alternative Name(s): CNTF

Gene Names: CNTF

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-200aa

Sequence Info: Full Length of Mature Protein

MW: 26.8

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Reference: "Expression and characterization of recombinant human ciliary neurotrophic factor from Escherichia coli." McDonald J.R., Ko C., Mismer D., Smith D.J., Collins F. Biochim. Biophys. Acta 1090:70-80(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26441

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose