null

Recombinant Human C-C motif chemokine 24 (CCL24) | CSB-EP004788HU

(No reviews yet) Write a Review
SKU:
CSB-EP004788HU
Availability:
13 - 23 Working Days
  • Recombinant Human C-C motif chemokine 24 (CCL24)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human C-C motif chemokine 24 (CCL24) | CSB-EP004788HU | Cusabio

Alternative Name(s): CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 ;MPIF-2Small-inducible cytokine A24

Gene Names: CCL24

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 27-119aa

Sequence Info: Full Length of Mature Protein

MW: 14.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic for resting T-lymphocytes, and eosinophils. Has lower chotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hatopoietic progenitor cell line. Binds to CCR3.

Reference: Molecular and functional characterization of two novel human C-C chemokines as inhibitors of two distinct classes of myeloid progenitors.Patel V.P., Kreider B.L., Li Y., Li H., Leung K., Salcedo T., Nardelli B., Pippalla V., Gentz S., Thotakura R., Parmelee D., Gentz R., Garotta G.J. Exp. Med. 185:1163-1172(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine beta (chemokine CC) family

Tissue Specificity: Activated monocytes and activated T lymphocytes.

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00175

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose