Recombinant Drosophila melanogaster Protein-L-isoaspartate (D-aspartate) O-methyltransferase (Pcmt) | CSB-EP635664DLU

(No reviews yet) Write a Review
SKU:
CSB-EP635664DLU
Availability:
3 - 7 Working Days
  • Recombinant Drosophila melanogaster Protein-L-isoaspartate (D-aspartate) O-methyltransferase (Pcmt)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Drosophila melanogaster Protein-L-isoaspartate (D-aspartate) O-methyltransferase (Pcmt) | CSB-EP635664DLU | Cusabio

Alternative Name(s): L-isoaspartyl protein carboxyl methyltransferase Protein L-isoaspartyl/D-aspartyl methyltransferase Protein-beta-aspartate methyltransferase dPIMT

Gene Names: Pcmt

Research Areas: Biochemicals

Organism: Drosophila melanogaster (Fruit fly)

AA Sequence: MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-226aa

Sequence Info: Full Length

MW: 32.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins

Reference: "Structural organization and developmental expression of the protein isoaspartyl methyltransferase gene from Drosophila melanogaster." O'Connor M.B., Galus A., Hartenstine M., Magee M., Jackson F.R., O'Connor C.M. Insect Biochem. Mol. Biol. 27:49-54(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q27869

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose