Cusabio Canis lupus familiaris Recombinants
Recombinant Dog Major allergen Can f 1 | CSB-EP519455DO
- SKU:
- CSB-EP519455DO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Dog Major allergen Can f 1 | CSB-EP519455DO | Cusabio
Alternative Name(s): Allergen Dog 1 Allergen: Can f 1
Gene Names: N/A
Research Areas: Others
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 19-174aa
Sequence Info: Full Length of Mature Protein
MW: 33.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "The major dog allergens, Can f 1 and Can f 2, are salivary lipocalin proteins: cloning and immunological characterization of the recombinant forms."Konieczny A., Morgenstern J.P., Bizinkauskas C.B., Lilley C.H., Brauer A.W., Bond J.F., Aalberse R.C., Wallner B.P., Kasaian M.T.Immunology 92:577-586(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Calycin superfamily, Lipocalin family
Tissue Specificity: Tongue epithelial tissue.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O18873
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A