Recombinant Bovine Apolipoprotein A-I (APOA1), partial | CSB-EP001913BO

Recombinant Bovine Apolipoprotein A-I (APOA1), partial | CSB-EP001913BO | Cusabio

Alternative Name(s): Apolipoprotein A1 (Apo-AI) (ApoA-I)

Gene Names: APOA1

Research Areas: Cardiovascular

Organism: Bos taurus (Bovine)

AA Sequence: DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 25-265aa

Sequence Info: Partial

MW: 41.5

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase. As part of the SPAP complex, activates spermatozoa motility.

Reference: "Carboxyl terminus of apolipoprotein A-I (ApoA-I) is necessary for the transport of lipid-free ApoA-I but not prelipidated ApoA-I particles through aortic endothelial cells." Ohnsorg P.M., Rohrer L., Perisa D., Kateifides A., Chroni A., Kardassis D., Zannis V.I., von Eckardstein A. J. Biol. Chem. 286:7744-7754(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Apolipoprotein A1/A4/E family

Tissue Specificity: Major protein of plasma HDL, also found in chylomicrons.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15497

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A