Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac) , partial | CSB-EP333489ACY

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac) , partial | CSB-EP333489ACY | Cusabio

Alternative Name(s): Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit

Gene Names: aac

Research Areas: Others

Organism: Actinoplanes utahensis

AA Sequence: GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-214aa

Sequence Info: Partial

MW: 35.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.

Reference: "Cloning and sequencing of the aculeacin A acylase-encoding gene from Actinoplanes utahensis and expression in Streptomyces lividans." Inokoshi J., Takeshima H., Ikeda H., Omura S.Gene 119:29-35(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S45 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P29958

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A